PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.03G203700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family GRAS
Protein Properties Length: 553aa    MW: 61863.4 Da    PI: 5.811
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.03G203700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS200.31.2e-611955471374
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          lvelLl+  e + +++  +a+ lL +   l+s++g+++qR+++yf +AL++r++r      ++ + ++++  +  ++l ++++    +Pi
  Manes.03G203700.1.p 195 LVELLLASTENIVNQQYDQASILLDKCDALSSSTGNAVQRVVHYFSKALRKRINR------DTGRITTQD-LEKLQSLRIHEINMAPTPI 277
                          678999999**********************************************......444444443.2345555666666666777 PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefn 179
                          +  +h    ++    v++ + v      i  G+QW  L+qaLas++e p   l+iT++g    ++k+ +e tg+rL+ fA+++ +pf f+
  Manes.03G203700.1.p 278 VLACHR---EMPFSQVANFTGVQ-----IIIGVQWTGLMQALASQSEHPLeLLKITAIGT---TKKHLIEDTGKRLEGFAQTISLPFCFK 356
                          666664...44456666666664.....558**************96655499*******...579999********************* PP

                 GRAS 180 vlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                          +++++++ dl+ + ++++ +E+++V + ++l        sl+++ d+v++++++l+P+++ vve e++++ +sF++r +eal ++ a fd
  Manes.03G203700.1.p 357 LIMVSDMLDLREDLFELDDDETVVVYSGFSLRGPI----SLPDRLDSVMQVIRNLNPHLLLVVEPELSLSLTSFVNRTVEALGFFGAYFD 442
                          *****************************887776....99999999******************************************* PP

                 GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgsl 358
                          +le  + +++ +ri  E  ll++ i+ ++ +eg+e + r+ +l  Wr+ + ++G+++ ++s++  +qa+l+ +k++ ++  ++  + gsl
  Manes.03G203700.1.p 443 CLEDCM-SDDPTRIIKESSLLSEGISIAIDHEGKEWKSRCAKLDAWRAFFARFGMEETKMSSSSLCQANLVAKKFAgGNSCTLAVDGGSL 531
                          **9996.889******************************************************************9999********** PP

                 GRAS 359 vlgWkdrpLvsvSaWr 374
                          ++gWk++p++s+SaW+
  Manes.03G203700.1.p 532 LIGWKGKPMYSLSAWK 547
                          ***************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098526.963169526IPR005202Transcription factor GRAS
PfamPF035144.0E-59195547IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 553 aa     Download sequence    Send to blast
METSEEFDFG EVHDRLSSTD QSSEILEVEN GKKQVPGYID EDWGESTAID SHHPDKRSSK  60
DDPSKEGSVF THHHQQQELK QQSVLKPRQS FPKEITEQTK KEKQDSFPPA SLEILKCYGK  120
GLKRLRNQKI MEATNGKTTL KVASPRLSTE EIIRTAGKRA FQSFNNMVDV SSMQDNPFDV  180
SFSCLSNEDA KKVELVELLL ASTENIVNQQ YDQASILLDK CDALSSSTGN AVQRVVHYFS  240
KALRKRINRD TGRITTQDLE KLQSLRIHEI NMAPTPIVLA CHREMPFSQV ANFTGVQIII  300
GVQWTGLMQA LASQSEHPLE LLKITAIGTT KKHLIEDTGK RLEGFAQTIS LPFCFKLIMV  360
SDMLDLREDL FELDDDETVV VYSGFSLRGP ISLPDRLDSV MQVIRNLNPH LLLVVEPELS  420
LSLTSFVNRT VEALGFFGAY FDCLEDCMSD DPTRIIKESS LLSEGISIAI DHEGKEWKSR  480
CAKLDAWRAF FARFGMEETK MSSSSLCQAN LVAKKFAGGN SCTLAVDGGS LLIGWKGKPM  540
YSLSAWKFVS QK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-2221454722375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012084258.10.0PREDICTED: DELLA protein RGL1-like
TrEMBLA0A067JYQ20.0A0A067JYQ2_JATCU; Uncharacterized protein
STRINGPOPTR_0010s15370.11e-161(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.11e-28RGA-like 1